General Information

  • ID:  hor005440
  • Uniprot ID:  P0C236
  • Protein name:  Insulin B chain
  • Gene name:  ins
  • Organism:  Polypterus senegalus (Senegal bichir)
  • Family:  insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Polypterus (genus), Polypteridae (family), Polypteriformes (order), Cladistia (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AANRHLCGSHLVEALYLVCGNRGFFYIPSKM
  • Length:  31(1-31)
  • Propeptide:  AANRHLCGSHLVEALYLVCGNRGFFYIPSKMGIVEQCCDTPCSLYDPENYCN
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P0C236-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005440_AF2.pdbhor005440_ESM.pdb

Physical Information

Mass: 400337 Formula: C156H240N44O40S3
Absent amino acids: DQTW Common amino acids: L
pI: 8.78 Basic residues: 5
Polar residues: 11 Hydrophobic residues: 12
Hydrophobicity: 29.68 Boman Index: -2008
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 91.29
Instability Index: 3672.9 Extinction Coefficient cystines: 3105
Absorbance 280nm: 103.5

Literature

  • PubMed ID:  9446726
  • Title:  Purification and structural characterization of insulin and glucagon from the bichir Polypterus senegalis (Actinopterygii: Polypteriformes).